PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14377_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 53aa    MW: 5791.49 Da    PI: 9.8944
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14377_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-131452139
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39
                                         +g+WT+eEd++lvd++++ G gtW++ ++  g+ R++k+
  cra_locus_14377_iso_4_len_309_ver_3 14 KGAWTPEEDKILVDYINKNGHGTWRSLPKLAGLLRCGKS 52
                                         79******************************99*9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-14552IPR009057Homeodomain-like
PROSITE profilePS5129412.832953IPR017930Myb domain
SuperFamilySSF466893.59E-9948IPR009057Homeodomain-like
PfamPF002497.2E-111452IPR001005SANT/Myb domain
CDDcd001679.72E-61652No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
MGRSPCCDKG GVKKGAWTPE EDKILVDYIN KNGHGTWRSL PKLAGLLRCG KSX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364874.12e-27PREDICTED: transcription factor MYB39
SwissprotQ7XBH41e-23MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A068UAM33e-28A0A068UAM3_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000163946e-27(Solanum tuberosum)